Primary Antibodies

Jump to Filters
View as table Download
Malectin (MLEC) Rabbit Polyclonal Antibody
TA308982

USD 415.00

5 Days

Rabbit polyclonal antibody to Malectin (Malectin)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 106 and 292 of Malectin (Uniprot ID#Q14165)
Malectin (MLEC) Rabbit Polyclonal Antibody
TA339315

USD 375.00

5 Days

Rabbit Polyclonal Anti-KIAA0152 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIAA0152 antibody: synthetic peptide directed towards the C terminal of human KIAA0152. Synthetic peptide located within the following region: TVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNP