Primary Antibodies

Jump to Filters
View as table Download
PLOD2 Rabbit Polyclonal Antibody
TA329518

USD 375.00

5 Days

Rabbit Polyclonal anti-PLOD2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLOD2 antibody: synthetic peptide directed towards the middle region of human PLOD2. Synthetic peptide located within the following region: IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM
PLOD2 Rabbit Polyclonal Antibody
TA380054

USD 220.00

3 Weeks

PLOD2 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 470-650 of human PLOD2 (NP_891988.1).
Modifications Unmodified