Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SIL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIL1 Antibody: synthetic peptide directed towards the N terminal of human SIL1. Synthetic peptide located within the following region: KETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAK

Goat Polyclonal Antibody against BAP / SIL1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ELLGSVNSLLKELR, from the C Terminus of the protein sequence according to NP_071909.1.

Rabbit Polyclonal Anti-SIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIL1 Antibody: synthetic peptide directed towards the C terminal of human SIL1. Synthetic peptide located within the following region: KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR

SIL1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SIL1