Rabbit Polyclonal Anti-SLC8A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC8A1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SLC8A1. Synthetic peptide located within the following region: CTGSYYCKKGVILPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADR |
SLC8A1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 250-520 of human SLC8A1 (NP_066920.1). |
| Modifications | Unmodified |
SLC8A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 250-520 of human SLC8A1 (NP_066920.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China