Primary Antibodies

View as table Download

Rabbit polyclonal SSTR1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SSTR1.

Rabbit Polyclonal Anti-SSTR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSTR1 antibody: synthetic peptide directed towards the C terminal of human SSTR1. Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD

Rabbit Polyclonal Anti-SSTR1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sstr1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sstr1. Synthetic peptide located within the following region: QRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTC

Anti-SSTR1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of human somatostatin receptor 1

SSTR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 292-391 of human SSTR1 (NP_001040.1).
Modifications Unmodified