Primary Antibodies

Jump to Filters
View as table Download
TRPM4 Rabbit Polyclonal Antibody
TA338581

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRPM4 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI
TRPM4 Rabbit Polyclonal Antibody
TA382870

USD 220.00

3 Weeks

TRPM4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human TRPM4 (NP_060106.2).
Modifications Unmodified