Primary Antibodies

Jump to Filters
View as table Download
IL28 Receptor alpha (IFNLR1) Rabbit Polyclonal Antibody
TA346513

USD 475.00

5 Days

Rabbit Polyclonal Anti-IL28RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
IL28 Receptor alpha (IFNLR1) Rabbit Polyclonal Antibody
TA346514

USD 475.00

5 Days

Rabbit Polyclonal Anti-IL28RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV
IL28 Receptor alpha (IFNLR1) Mouse Monoclonal Antibody [Clone ID: OTI3D5]
CF812608

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IFNLR1 mouse monoclonal antibody,clone OTI3D5

Applications WB
Reactivities Human
Conjugation Unconjugated
IL28 Receptor alpha (IFNLR1) Mouse Monoclonal Antibody [Clone ID: OTI1B1]
CF812612

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) IFNLR1 mouse monoclonal antibody,clone OTI1B1

Applications WB
Reactivities Human
Conjugation Unconjugated
IL28 Receptor alpha (IFNLR1) Mouse Monoclonal Antibody [Clone ID: OTI7B2]
CF812616

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) IFNLR1 mouse monoclonal antibody,clone OTI7B2

Applications WB
Reactivities Human
Conjugation Unconjugated