Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-LAPTM4B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAPTM4B antibody: synthetic peptide directed towards the middle region of human LAPTM4B. Synthetic peptide located within the following region: YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS

Rabbit Polyclonal Anti-LAPTM4B Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Laptm4b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Laptm4b. Synthetic peptide located within the following region: SCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDATAVPSTAKEPPPPYVSA