Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FGF11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF11 antibody is: synthetic peptide directed towards the N-terminal region of Human FGF11. Synthetic peptide located within the following region: LASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLC

Rabbit Polyclonal Anti-FGF11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF11 antibody: synthetic peptide directed towards the N terminal of human FGF11. Synthetic peptide located within the following region: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKL