Primary Antibodies

Jump to Filters
View as table Download
GABA B Receptor 2 (GABBR2) Rabbit Polyclonal Antibody
TA328675

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-GABA (B) R2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CKDPIEDINSPEHIQRRLSL, corresponding to amino acid residues 875-894 of human GABA(B) R2. Intracellular, C-terminus.
GABA B Receptor 2 (GABBR2) Rabbit Polyclonal Antibody
TA343112

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GABBR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABBR2 antibody: synthetic peptide directed towards the C terminal of human GABBR2. Synthetic peptide located within the following region: QFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLE
GABA B Receptor 2 (GABBR2) Rabbit Polyclonal Antibody
TA312880

USD 345.00

4 Weeks

Rabbit polyclonal GABBR2 (Ab-893) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human GABBR2.
GABA B Receptor 2 (GABBR2) Rabbit Polyclonal Antibody
TA336615

USD 350.00

5 Days

Rabbit Polyclonal GABA-B R2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to the 105 kDa GABAbR2 protein.