Primary Antibodies

Jump to Filters
View as table Download
OR10J5 (C-term) Rabbit Polyclonal Antibody
AP53011PU-N

USD 450.00

2 Weeks

OR10J5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 250-278 amino acids from the C-terminal region of human OR10J5
OR10J5 Rabbit Polyclonal Antibody
TA332321

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR10J5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10J5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10J5. Synthetic peptide located within the following region: CIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTF