liver FABP (FABP1) mouse monoclonal antibody, clone 2G4, Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
liver FABP (FABP1) mouse monoclonal antibody, clone 2G4, Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Rabbit anti-FABP1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FABP1 |
liver FABP (FABP1) mouse monoclonal antibody, clone 2G4, Purified
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
liver FABP (FABP1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human FABP1 |
Rabbit polyclonal anti-FABP3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli expressed human FABP3 |
Rabbit Polyclonal Anti-FABP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP1 antibody: synthetic peptide directed towards the N terminal of human FABP1. Synthetic peptide located within the following region: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF |
Rabbit Polyclonal Anti-FABP1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FABP1 |