Primary Antibodies

Jump to Filters
View as table Download
Myosin Heavy chain 1 (MYH1) Rabbit Polyclonal Antibody
TA346424

USD 475.00

5 Days

Rabbit Polyclonal Anti-MYH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH1 antibody: synthetic peptide directed towards the N terminal of human MYH1. Synthetic peptide located within the following region: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK
CMH1 (MYH7) (slow) Mouse Monoclonal Antibody [Clone ID: IML-64]
AM20643PU-N

USD 405.00

2 Weeks

CMH1 (MYH7) (slow) mouse monoclonal antibody, clone IML-64, Purified

Applications IHC, WB
Reactivities Human, Rat