Primary Antibodies

View as table Download

MAFA (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 209~238 amino acids from the Central region of Human MAFA.

MAFA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 285-315 amino acids from the C-terminal region of human MAFA

MAFA (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 288~318 amino acids from the C-terminal region of human MAFA

Rabbit Polyclonal Anti-MAFA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFA antibody: synthetic peptide directed towards the N terminal of human MAFA. Synthetic peptide located within the following region: KPALEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAA

Rabbit Polyclonal Anti-MAFA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFA antibody: synthetic peptide directed towards the N terminal of human MAFA. Synthetic peptide located within the following region: PSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMS