Primary Antibodies

Jump to Filters
View as table Download
AMD1 Rabbit Polyclonal Antibody
TA323135

USD 345.00

In Stock

Anti-AMD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1
AMD1 Rabbit Polyclonal Antibody
TA373037

USD 380.00

4 Weeks

AMD1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human AMD1
TA373037 is a possible alternative to TA323135.
AMD1 Rabbit Polyclonal Antibody
TA334966

USD 375.00

5 Days

Rabbit Polyclonal Anti-AMD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMD1 antibody: synthetic peptide directed towards the N terminal of human AMD1. Synthetic peptide located within the following region: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV
AMD1 Rabbit Polyclonal Antibody
TA373483

USD 220.00

3 Weeks

AMD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 75-334 of human AMD1 (NP_001625.2).
Modifications Unmodified