Primary Antibodies

Jump to Filters
View as table Download
FAM3C Rabbit Polyclonal Antibody
TA336975

USD 424.00

5 Days

Rabbit Polyclonal FAM3C Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acids 40-80 of human FAM3C was used as the immunogen for this antibody.
FAM3C Rabbit Polyclonal Antibody
TA335977

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM3C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM3C Antibody: synthetic peptide directed towards the C terminal of human FAM3C. Synthetic peptide located within the following region: DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
FAM3C Rabbit Polyclonal Antibody
TA359402

USD 360.00

5 Days

FAM3C Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM3C