Primary Antibodies

View as table Download

Anti-GRK4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 36-145 amino acids of human G protein-coupled receptor kinase 4

Rabbit Polyclonal Anti-GRK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY

Rabbit Polyclonal Anti-GRK4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: EKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGA

Carrier-free (BSA/glycerol-free) GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-GRK4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 36-145 amino acids of human G protein-coupled receptor kinase 4

GRK4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 359-578 of human GRK4 (NP_892027.2).
Modifications Unmodified

GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)

Applications WB
Reactivities Human
Conjugation Unconjugated

GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)

Applications WB
Reactivities Human
Conjugation Unconjugated

GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications WB
Reactivities Human
Conjugation Unconjugated

GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)

Applications WB
Reactivities Human
Conjugation Unconjugated