Primary Antibodies

Jump to Filters
View as table Download
Glycerol kinase (GK) Rabbit Polyclonal Antibody
TA313926

USD 345.00

In Stock

Rabbit polyclonal anti-GLPK antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GLPK.
Glycerol kinase (GK) Rabbit Polyclonal Antibody
TA347798

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GK Antibody: A synthesized peptide derived from human GK
Gk Rabbit Polyclonal Antibody
TA333891

USD 375.00

5 Days

Rabbit Polyclonal Anti-Gyk Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gyk Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gyk. Synthetic peptide located within the following region: DKVTGEPLYNAVVWLDLRTQSTVENLSKRIPGNNNFVKSKTGLPLSTYFS
Glycerol kinase (GK) Rabbit Polyclonal Antibody
TA376583

USD 220.00

3 Weeks

Glycerol kinase (GK) Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 251-530 of human Glycerol kinase (Glycerol kinase (GK)) (NP_976325.1).
Modifications Unmodified