Rabbit polyclonal anti-GLPK antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human GLPK. |
Rabbit polyclonal anti-GLPK antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human GLPK. |
Rabbit Polyclonal Anti-GK Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GK Antibody: A synthesized peptide derived from human GK |
Rabbit Polyclonal Anti-Gyk Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Gyk Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gyk. Synthetic peptide located within the following region: DKVTGEPLYNAVVWLDLRTQSTVENLSKRIPGNNNFVKSKTGLPLSTYFS |
Glycerol kinase (GK) Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 251-530 of human Glycerol kinase (Glycerol kinase (GK)) (NP_976325.1). |
Modifications | Unmodified |