Primary Antibodies

View as table Download

Goat Anti-GLP-1-R (mouse) Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-SKRGERNFPEEQ, from the internal region of the protein sequence according to NP_067307.2.

Rabbit Polyclonal GLP-1R Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human GLP1R protein (between residues 250-350) [UniProt P43220]

Rabbit Polyclonal Anti-Glp1r Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Glp1r antibody is: synthetic peptide directed towards the middle region of Mouse Glp1r. Synthetic peptide located within the following region: YRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLYIIYTV

Goat Anti-GLP1R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QHQWDGLLSYQD, from the internal region of the protein sequence according to NP_002053.3.

GLP1R Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-116 of human GLP1R (NP_002053.3).
Modifications Unmodified