Primary Antibodies

Jump to Filters
View as table Download
GPR4 Rabbit Polyclonal Antibody
TA308713

USD 415.00

2 Weeks

Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093)
Gpr4 Rabbit Polyclonal Antibody
TA337760

USD 375.00

5 Days

Rabbit Polyclonal Anti-Gpr4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gpr4 antibody is: synthetic peptide directed towards the middle region of Mouse Gpr4. Synthetic peptide located within the following region: LCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFAPYHALLLSRS