Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093) |
Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093) |
Rabbit Polyclonal Anti-Gpr4 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Gpr4 antibody is: synthetic peptide directed towards the middle region of Mouse Gpr4. Synthetic peptide located within the following region: LCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFAPYHALLLSRS |