Rabbit Polyclonal Anti-Rfxap Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rfxap antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CTYEGCRETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALGSGGPSA |
Rabbit Polyclonal Anti-Rfxap Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rfxap antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DAEDEAGDDDADLLDTSDPAGGGESAASPEELEDEDAEGGGAARRRGSKT |
RFXAP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-272 of human RFXAP (NP_000529.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China