Primary Antibodies

View as table Download

Rabbit polyclonal anti-RPS8 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPS8.

Rabbit Polyclonal Anti-Rps8 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rps8 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rps8. Synthetic peptide located within the following region: KKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELE

RPS8 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPS8.