Primary Antibodies

Jump to Filters
View as table Download
G3BP (G3BP1) Rabbit Polyclonal Antibody
TA331473

USD 375.00

5 Days

Rabbit polyclonal Anti-G3BP1 Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-G3BP1 antibody: synthetic peptide directed towards the N terminal of human G3BP1. Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
G3BP (G3BP1) Rabbit Polyclonal Antibody
TA376419

USD 220.00

3 Weeks

G3BP1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 131-330 of human G3BP1 (NP_938405.1).
Modifications Unmodified