Rabbit Polyclonal Anti-LDHAL6B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LDHAL6B Antibody: synthetic peptide directed towards the middle region of human LDHAL6B. Synthetic peptide located within the following region: SGVNIAGVPLKDLNSDIGTDKDPEQWKNVHKEVTATAYEIIKMKGYTSWA |
LDHAL6B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LDHAL6B |
LDHAL6B Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human LDHAL6B (NP_149972.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China