Primary Antibodies

View as table Download

PHGDH mouse monoclonal antibody, clone 4A3-1D6, Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human

PHGDH (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human PHGDH

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: SLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPA

Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHGDH

PHGDH Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 264-533 of human PHGDH (NP_006614.2).
Modifications Unmodified

PHGDH Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PHGDH.
Modifications Unmodified

PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated