Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TINAG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TINAG antibody: synthetic peptide directed towards the middle region of human TINAG. Synthetic peptide located within the following region: VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG

Rabbit Polyclonal Anti-Tinag Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for anti-Tinag antibody is: synthetic peptide directed towards the middle region of Rat Tinag. Synthetic peptide located within the following region: SPPYRISSNETEIMREIIQNGPVQAIMQVHEDFFYYKTGIYRHVVSTNEE