Primary Antibodies

Jump to Filters
View as table Download
WNT6 Rabbit Polyclonal Antibody
TA318924

USD 355.00

3 Weeks

Rabbit polyclonal anti-Wnt-6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 276 of mouse Wnt-6
WNT6 (Center) Rabbit Polyclonal Antibody
AP54569PU-N

USD 450.00

2 Weeks

WNT6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 172-201 amino acids from the Central region of human WNT6
WNT6 Rabbit Polyclonal Antibody
TA341844

USD 375.00

5 Days

Rabbit Polyclonal Anti-WNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT6 antibody: synthetic peptide directed towards the middle region of human WNT6. Synthetic peptide located within the following region: ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG
Wnt6 Rabbit Polyclonal Antibody
TA341845

USD 375.00

5 Days

Rabbit Polyclonal Anti-Wnt6 Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for Anti-Wnt6 antibody is: synthetic peptide directed towards the middle region of RAT Wnt6. Synthetic peptide located within the following region: PGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQL