Primary Antibodies

Jump to Filters
View as table Download
ABCA2 Rabbit Polyclonal Antibody
TA332134

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ABCA2. Synthetic peptide located within the following region: ILPVMQSLCPDGQRDEFGFLQYANSTVTQLLERLDRVVEEGNLFDPARPS
ABCA2 Rabbit Polyclonal Antibody
TA373121

USD 275.00

3 Weeks

ABCA2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2307-2466 of human ABCA2 (NP_997698.1).
Modifications Unmodified