Primary Antibodies

View as table Download

Rabbit anti-ABCB8 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCB8.

Rabbit Polyclonal Anti-Abcb8 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abcb8 Antibody is: synthetic peptide directed towards the middle region of Mouse Abcb8. Synthetic peptide located within the following region: ADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSN

Rabbit Polyclonal Anti-ABCB8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCB8 Antibody: synthetic peptide directed towards the middle region of human ABCB8. Synthetic peptide located within the following region: EPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVG

Anti-ABCB8 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8

Anti-ABCB8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8

ABCB8 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 469-718 of human ABCB8 (NP_009119.2).
Modifications Unmodified