Adgre1 rat monoclonal antibody, clone Cl:A3-1, Purified
Applications | EM, FC, IF, IHC, IP, R, WB |
Reactivities | Mouse |
Adgre1 rat monoclonal antibody, clone Cl:A3-1, Purified
Applications | EM, FC, IF, IHC, IP, R, WB |
Reactivities | Mouse |
Adgre1 rat monoclonal antibody, clone Cl:A3-1, Low Endotoxin
Applications | FC, FN, IF, IHC, IP, R, WB |
Reactivities | Mouse |
Adgre1 rat monoclonal antibody, clone Cl:A3-1, Biotin
Applications | FC, IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Biotin |
Rabbit Polyclonal antibody to EMR1 (egf-like module containing, mucin-like, hormone receptor-like 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 626 and 886 of EMR1 (Uniprot ID#Q14246) |
Rabbit polyclonal anti-EMR1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human EMR1. |
Rabbit Polyclonal Anti-EMR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EMR1 antibody is: synthetic peptide directed towards the C-terminal region of Human EMR1. Synthetic peptide located within the following region: GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG |
EMR1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-290 of human EMR1 (NP_001243182.1). |
Modifications | Unmodified |
F4/80 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of Mouse F4/80. |