Primary Antibodies

Jump to Filters
View as table Download
B3GNT7 Rabbit Polyclonal Antibody
TA329585

USD 375.00

5 Days

Rabbit polyclonal anti-B3GNT7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GNT7 antibody: synthetic peptide directed towards the N terminal of human B3GNT7. Synthetic peptide located within the following region: QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR
B3gnt7 Rabbit Polyclonal Antibody
TA356760

USD 360.00

5 Days

B3gnt7 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated