Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CYP3A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI

Rabbit Polyclonal Anti-CYP3A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG

Rabbit polyclonal Cytochrome P450 3A7 antibody

Applications WB
Reactivities Human
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A7.

CYP3A7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 244-503 of human CYP3A7 (NP_000756.3).
Modifications Unmodified