Primary Antibodies

Jump to Filters
View as table Download
DHDH Rabbit Polyclonal Antibody
TA334542

USD 375.00

5 Days

Rabbit Polyclonal Anti-DHDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHDH antibody: synthetic peptide directed towards the middle region of human DHDH. Synthetic peptide located within the following region: PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK
DHDH Rabbit Polyclonal Antibody
TA375445

USD 220.00

3 Weeks

DHDH Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human DHDH (NP_055290.1).
Modifications Unmodified