Primary Antibodies

View as table Download

Rabbit polyclonal DVL1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1.

Rabbit Polyclonal Anti-DVL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the middle region of human DVL1. Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK

Dvl1 Goat Polyclonal Antibody

Applications WB
Reactivities Pig
Conjugation Unconjugated
Immunogen N Terminus (KLPVAPERVTLAD)

Rabbit Polyclonal Anti-DVL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the C terminal of human DVL1. Synthetic peptide located within the following region: AAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPP

DVL1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 510-640 of human DVL1 (NP_004412.2).
Modifications Unmodified