FBXW8 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 273-303 amino acids from the Central region of human FBXW8 |
FBXW8 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 273-303 amino acids from the Central region of human FBXW8 |
Rabbit polyclonal Anti-FBXW8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBXW8 antibody: synthetic peptide directed towards the middle region of human FBXW8. Synthetic peptide located within the following region: MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR |
Rabbit polyclonal Anti-FBXW8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBXW8 antibody: synthetic peptide directed towards the middle region of human FBXW8. Synthetic peptide located within the following region: RNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYD |
FBXW8 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FBXW8. |