Primary Antibodies

Jump to Filters
View as table Download
GNPTAB Rabbit Polyclonal Antibody
TA338655

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNPTAB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNPTAB antibody: synthetic peptide directed towards the N terminal of human GNPTAB. Synthetic peptide located within the following region: FQFGEVVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNG
GNPTAB Rabbit Polyclonal Antibody
TA376668

USD 220.00

3 Weeks

GNPTAB Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-350 of human GNPTAB (NP_077288.2).
Modifications Unmodified