Primary Antibodies

View as table Download

Rabbit anti-KCNJ11 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human KCNJ11

Goat Polyclonal Antibody against Kcnj11 (Near N-terminal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ERRARFVSKKGNC, from the internal region (near the N Terminus) of the protein sequence according to NP_034732.1.

Rabbit polyclonal Anti-Kir6.2

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)SVAVAKAKPKFSIS, corresponding to amino acid residues 372-385 of rat Kir6.2 . Intracellular, C-terminal part.

Goat Polyclonal Antibody against KCNJ11

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-AEDPAKPRYRARQ, from the internal region (near the N Terminus) of the protein sequence according to NP_000516.3.

Rabbit Polyclonal Anti-KCNJ11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KCNJ11 antibody is: synthetic peptide directed towards the middle region of HUMAN KCNJ11. Synthetic peptide located within the following region: SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLII