Primary Antibodies

Jump to Filters
View as table Download
Laminin (LAMC3) Rabbit Polyclonal Antibody
TA338136

USD 375.00

5 Days

Rabbit Polyclonal Anti-LAMC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMC3 antibody is: synthetic peptide directed towards the C-terminal region of Human LAMC3. Synthetic peptide located within the following region: ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLT