Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NFAT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFAT5 antibody: synthetic peptide directed towards the middle region of human NFAT5. Synthetic peptide located within the following region: PGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGN

Rabbit polyclonal NFAT5/TonEBP (Ser155) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NFAT5/TonEBP around the phosphorylation site of serine 155 (D-N-SP-R-M).
Modifications Phospho-specific

Rabbit Polyclonal Anti-NFAT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFAT5 antibody: synthetic peptide directed towards the middle region of mouse NFAT5. Synthetic peptide located within the following region: TIQTQDISQPGTFPAVSAASQLPSSDALLQQATQFQTREAQSRDTIQSDT

NFAT5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1300 to the C-terminus of human NFAT5 (NP_619728.2).
Modifications Unmodified

NFAT5 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide from human protein at AA range: 212-284