Primary Antibodies

View as table Download

OR5B12 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 285-314 amino acids from the C-terminal region of human Olfactory receptor 5B12

Rabbit Polyclonal Anti-OR5B12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5B12 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5B12. Synthetic peptide located within the following region: EMVIFFVVGFNDLFSILVILISYLFIFITIMKMRSPEGRQKAFSTCASHL