Primary Antibodies

View as table Download

Goat Anti-PSMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NLYELKEGRQ, from the internal region of the protein sequence according to NP_002786.2.

Rabbit polyclonal Anti-PSMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB3 antibody: synthetic peptide directed towards the middle region of human PSMB3. Synthetic peptide located within the following region: LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF

PSMB3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMB3

PSMB3 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human PSMB3 (NP_002786.2).
Modifications Unmodified