Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal Anti-RAB1A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB1A antibody: synthetic peptide directed towards the middle region of human RAB1A. Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC |
RAB1A Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse RAB1A |
RAB1A Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB1A (NP_004152.1). |
| Modifications | Unmodified |
RAB1A Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human RAB1A (NP_004152.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RAB1A
Applications
- WB