Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SIPA1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIPA1 antibody: synthetic peptide directed towards the middle region of human SIPA1. Synthetic peptide located within the following region: TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS

SIM1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SIM1

Goat Polyclonal Antibody against SIM1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SGDRYRTEQYQS, from the internal region of the protein sequence according to NP_005059.2.

SIM1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SIM1