Primary Antibodies

View as table Download

Rabbit polyclonal anti-FATP4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 598 of rat FATP4

Rabbit Polyclonal Anti-SLC27A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC27A4 Antibody: synthetic peptide directed towards the middle region of human SLC27A4. Synthetic peptide located within the following region: YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL

SLC27A4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SLC27A4

SLC27A4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SLC27A4

SLC27A4 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 574-643 of human SLC27A4 (NP_005085.2).
Modifications Unmodified