Rabbit Polyclonal Anti-SLC5A9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC5A9 |
Rabbit Polyclonal Anti-SLC5A9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC5A9 |
Rabbit Polyclonal Anti-SLC5A9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC5A9 Antibody: synthetic peptide directed towards the N terminal of human SLC5A9. Synthetic peptide located within the following region: MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA |
SLC5A9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-320 of human SLC5A9 (NP_001011547.2). |
Modifications | Unmodified |