Primary Antibodies

View as table Download

Rabbit Polyclonal SOX11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A partial recombinant portion of human SOX11 (between residues 50-300) [UniProt P35716]

Goat Anti-SOX11 (aa309-323) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRLYYSFKNITKQHP, from the internal region of the protein sequence according to NP_003099.1.

Rabbit Polyclonal Anti-SOX11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the N terminal of human SOX11. Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK

Rabbit Polyclonal Anti-SOX11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the middle region of human SOX11. Synthetic peptide located within the following region: PHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAG

Rabbit Polyclonal Anti-SOX11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the N terminal of human SOX11. Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK

Rabbit Polyclonal Anti-SOX11 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SOX11

SOX11 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOX11

SOX11 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOX11

SOX11 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human SOX11.
Modifications Unmodified

SOX11 rabbit monoclonal antibody, clone OTIR3D12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SOX11 rabbit monoclonal antibody, clone OTIR3D12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated