Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Somatostatin Receptor 1 (SSTR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 20-70 of Human SSTR1 |
Somatostatin Receptor 1 (SSTR1) rabbit polyclonal antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SSTR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSTR1 antibody: synthetic peptide directed towards the C terminal of human SSTR1. Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD |
Rabbit Polyclonal Somatostatin Receptor 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Raised against a synthetic peptide from the c-terminus of rat SSR1 receptor conjugated to cysteine. |
Rabbit polyclonal Anti-Somatostatin Receptor Type I (extracellular)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CSRGPGSGAADGMEE, corresponding to amino acid? residues 26-40 of rat somatostatin receptor type 1 (Accession# P28646). Extracellular, N-terminus. |
Rabbit Polyclonal Anti-SSTR1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sstr1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sstr1. Synthetic peptide located within the following region: QRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTC |
SSTR1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SSTR1 |
SSTR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 292-391 of human SSTR1 (NP_001040.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SSTR1
Applications
- WB