Primary Antibodies

View as table Download

Rabbit Polyclonal 12-Lipoxygenase Antibody

Applications ELISA, IF, IHC
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal ALOX12 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALOX12 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 618-650 amino acids from the C-terminal region of human ALOX12.

Rabbit Polyclonal Anti-ALOX12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALOX12 Antibody: synthetic peptide directed towards the C terminal of human ALOX12. Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF