Rabbit Polyclonal Anti-CSH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS |
Rabbit Polyclonal hPL Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Placental lactogen (CSH1) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-207 of human Placental lactogen (Placental lactogen (CSH1)) (NP_001308.1). |
| Modifications | Unmodified |
Placental Lactogen Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from human protein at AA range: 161-210 |
Germany
Japan
United Kingdom
China
