Rabbit Polyclonal Anti-OR3A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR3A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR3A1. Synthetic peptide located within the following region: CGSHLTVVAIFYGSGIFNYMRLGSTKLSDKDKAVGIFNTVINPMLNPIIY |
Rabbit Polyclonal Anti-OR3A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR3A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR3A1. Synthetic peptide located within the following region: IMAGTPMALIVISYIHVAAAVLRIRSVEGRKKAFSTCGSHLTVVAIFYGS |
OR3A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 254-315 of human OR3A1 (NP_002541.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China